AIF antibody (AA 582-613)

Catalog No. ABIN2738204

Product Details anti-AIF Antibody

Target: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Binding Specificity: AA 582-613

Reactivity: Human, Mouse, Rat, Pig, Cow, Horse, Rabbit, Monkey, Hamster, Bat, Gibbon

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AIF antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Specificity: Detected in muscle and skin fibroblasts (at protein level). Isoform 5 is frequently down-regulated in human cancers. .

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human AIF(582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for AIF

Target: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Alternative Name: AIFM1 / AIF / PDCD8 (AIFM1 Products)

Synonyms: AIF antibody, CMTX4 antibody, COWCK antibody, COXPD6 antibody, PDCD8 antibody, CG7263 antibody, DmAIF antibody, Dmel\\CG7263 antibody, GB16024 antibody, DDBDRAFT_0187853 antibody, DDBDRAFT_0191137 antibody, DDB_0187853 antibody, DDB_0191137 antibody, aif antibody, pdcd8 antibody, AIFM1 antibody, PCD8 antibody, AIFsh2 antibody, Hq antibody, Pdcd8 antibody, mAIF antibody, Aif antibody, zgc:91994 antibody, apoptosis inducing factor mitochondria associated 1 antibody, allograft inflammatory factor 1 antibody, Apoptosis inducing factor antibody, apoptosis-inducing factor 1, mitochondrial antibody, apoptosis inducing factor antibody, apoptosis inducing factor, mitochondria associated 1 antibody, apoptosis-inducing factor, mitochondrion-associated, 1 antibody, apoptosis-inducing factor, mitochondrion-associated 1 antibody, AIFM1 antibody, AIF1 antibody, AIF antibody, LOC412212 antibody, aif antibody, aifm1 antibody, Aifm1 antibody

Background: Name/Gene ID: AIFM1
Family: Apoptosis

Synonyms: AIFM1, AIF, COXPD6, PDCD8, Programmed cell death 8

Gene ID: 9131

Pathways: Apoptosis, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration, Warburg Effect