HIF1A antibody (AA 703-732)

Catalog No. ABIN2741352

Product Details anti-HIF1A Antibody

Target: HIF1A (Hypoxia Inducible Factor 1, alpha Subunit (Basic Helix-Loop-Helix Transcription Factor) (HIF1A))

Binding Specificity: AA 703-732

Reactivity: Human, Mouse, Rat, Chimpanzee, Gibbon, Orang-Utan

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HIF1A antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Specificity: Expressed in most tissues with highest levels in kidney and heart. Overexpressed in the majority of common human cancers and their metastases, due to the presence of intratumoral hypoxia and as a result of mutations in genes encoding oncoproteins and tumor suppressors. A higher level expression seen in pituitary tumors as compared to the pituitary gland. .

Purification: Immunogen affinity purified

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminal of human HIF-1-alpha (703-732aa EEELNPKILALQNAQRKRKMEHDGSLFQAV), different from the related mouse and rat sequences by three amino acids.

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: avoid freeze thaw cycles

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Target Details for HIF1A

Target: HIF1A (Hypoxia Inducible Factor 1, alpha Subunit (Basic Helix-Loop-Helix Transcription Factor) (HIF1A))

Alternative Name: HIF1A / HIF1 alpha (HIF1A Products)

Synonyms: hif1a antibody, AA959795 antibody, HIF1alpha antibody, MOP1 antibody, bHLHe78 antibody, HIF-1A antibody, HIF-1alpha antibody, HIF1 antibody, HIF1-ALPHA antibody, PASD8 antibody, HIF1-alpha antibody, hif-1a antibody, hypoxia inducible factor 1 alpha antibody, hypoxia inducible factor 1, alpha subunit antibody, hypoxia inducible factor 1 alpha subunit antibody, HIF (Hypoxia Inducible Factor) homologa antibody, hif-1a antibody, Hif1a antibody, HIF1A antibody, hif1a antibody, hif-1 antibody

Background: Name/Gene ID: HIF1A

Synonyms: HIF1A, ARNT-interacting protein, ARNT interacting protein, BHLHe78, HIF1 Alpha, Hypoxia-inducible factor1alpha, HIF-1A, HIF1, MOP1, Member of PAS superfamily 1, PASD8, HIF-1-alpha, HIF-1alpha, HIF1-ALPHA, Member of PAS protein 1

Gene ID: 3091

Pathways: Positive Regulation of Peptide Hormone Secretion, Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Transition Metal Ion Homeostasis, Tube Formation, Regulation of Carbohydrate Metabolic Process, Signaling Events mediated by VEGFR1 and VEGFR2, VEGFR1 Specific Signals, Warburg Effect