EIF2AK2 antibody (C-Term)

Catalog No. ABIN3043824

Product Details anti-EIF2AK2 Antibody

Target: EIF2AK2 (Eukaryotic Translation Initiation Factor 2-alpha Kinase 2 (EIF2AK2))

Binding Specificity: AA 511-551, C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF2AK2 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Interferon-induced, double-stranded RNA-activated protein kinase(EIF2AK2) detection. Tested with WB in Human.

Sequence: EKTLLQKLLS KKPEDRPNTS EILRTLTVWK KSPEKNERHT C

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Interferon-induced, double-stranded RNA-activated protein kinase(EIF2AK2) detection. Tested with WB in Human.
Gene Name: eukaryotic translation initiation factor 2-alpha kinase 2
Protein Name: Interferon-induced, double-stranded RNA-activated protein kinase

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PKR(511-551aa EKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by thirteen amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for EIF2AK2

Target: EIF2AK2 (Eukaryotic Translation Initiation Factor 2-alpha Kinase 2 (EIF2AK2))

Alternative Name: EIF2AK2 (EIF2AK2 Products)

Synonyms: PKR antibody, pkr antibody, EIF2AK2 antibody, DKFZp469K1934 antibody, EIF2AK1 antibody, PRKR antibody, 2310047A08Rik antibody, 4732414G15Rik antibody, AI467567 antibody, AI747578 antibody, Pkr antibody, Prkr antibody, Tik antibody, eukaryotic translation initiation factor 2 alpha kinase 2 antibody, eukaryotic translation initiation factor 2-alpha kinase 2 antibody, EIF2AK2 antibody, eif2ak2 antibody, Eif2ak2 antibody

Background: EIF2AK2 (Eukaryotic Translation Initiation Factor 2-Alpha Kinase 2), also called PKR, is an enzyme that in humans is encoded by the EIF2AK2 gene. Activation of EIF2AK2 allows the kinase to phosphorylate its natural substrate, the alpha subunit of eukaryotic protein synthesis initiation factor-2, leading to the inhibition of protein synthesis. By FISH analysis, Squire et al. (1993) assigned the EIF2AK2 gene to the boundary between chromosome 2p22-p21. Ben-Asouli et al. (2002) showed that human gamma-interferon mRNA uses local activation of PKR in the cell to control its own translation yield. IFNG mRNA was found to activate PKR through a pseudoknot in its 5-prime untranslated region. Taylor et al. (1999) studied the mechanism underlying the resistance of hepatitis C virus (HCV) to interferon. They demonstrated that the HCV envelope protein E2 contains a sequence identical with phosphorylation sites of the interferon-inducible protein kinase PKR and the translation initiation factor EIF2-alpha, a target of PKR. E2 inhibited the kinase activity of PKR and blocked its inhibitory effect on protein synthesis and cell growth.

Synonyms: double stranded RNA activated protein kinase, antibody|E2AK2_HUMAN antibody|eIF-2A protein kinase 2 antibody|EIF2AK1 antibody|EIF2AK2 antibody|Eukaryotic translation initiation factor 2 alpha kinase 2 antibody|Eukaryotic translation initiation factor 2-alpha kinase 2 antibody|eukaryotic translation initiation factor 2-alpha kinase antibody|HGNC:9437 antibody|Interferon induced double stranded RNA activated protein kinase antibody|Interferon inducible elF2 alpha kinase antibody|Interferon inducible RNA dependent protein kinase antibody|Interferon inducible RNA-dependent protein kinase antibody|Interferon-induced, double-stranded RNA-activated protein kinase antibody|Interferon-inducible RNA-dependent protein kinase antibody|MGC126524 antibody|P1/eIF-2A protein kinase antibody|P1/eIF2A protein kinase antibody|p68 kinase antibody|PKR antibody|PRKR antibody|Protein kinase interferon inducible double stranded RNA dependent antibody|Protein kinase RNA activated antibody|Protein kinase RNA-activated antibody|Serine/threonine protein kinase TIK antibody|Serine/threonine-protein kinase TIK antibody|Tyrosine protein kinase EIF2AK2 antibody

Gene ID: 5610

UniProt: P19525

Pathways: DNA Damage Repair, ER-Nucleus Signaling, Hepatitis C