CRTC2 antibody

Catalog No. ABIN5692828

Product Details anti-CRTC2 Antibody

Target: CRTC2 (CREB Regulated Transcription Coactivator 2 (CRTC2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRTC2 antibody is un-conjugated

Application: Western Blotting (WB)

Brand: Picoband™

Sequence: EKIALQKQRQ AEETAAFEEV MMDIGSTRLQ AQKLRLAYTR

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for TORC2 detection. Tested with WB in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human TORC2 (EKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTR).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Target Details for CRTC2

Target: CRTC2 (CREB Regulated Transcription Coactivator 2 (CRTC2))

Alternative Name: CRTC2 (CRTC2 Products)

Synonyms: CRTC2 antibody, TORC-2 antibody, TORC2 antibody, 4632407F12Rik antibody, Torc2 antibody, mTORC2 antibody, RGD1308903 antibody, CREB regulated transcription coactivator 2 antibody, CRTC2 antibody, Crtc2 antibody

Background:

Synonyms: CREB-regulated transcription coactivator 2, Transducer of regulated cAMP response element-binding protein 2, TORC-2, Transducer of CREB protein 2, CRTC2, TORC2

Tissue Specificity: Most abundantly expressed in the thymus. Present in both B and T-lymphocytes. Highly expressed in HEK293T cells and in insulinomas. High levels also in spleen, ovary, muscle and lung, with highest levels in muscle. Lower levels found in brain, colon, heart, kidney, prostate, small intestine and stomach. Weak expression in liver and pancreas.

Background: CREB regulated transcription coactivator 2, also known as CRTC2, is a protein which in humans is encoded by the CRTC2 gene. This gene encodes a member of the transducers of regulated cAMP response element-binding protein activity family of transcription coactivators. These proteins promote the transcription of genes targeted by the cAMP response element-binding protein, and therefore play an important role in many cellular processes. Under basal conditions the encoded protein is phosphorylated by AMP-activated protein kinase or the salt-inducible kinases and is sequestered in the cytoplasm. Upon activation by elevated cAMP or calcium, the encoded protein translocates to the nucleus and increases target gene expression. Single nucleotide polymorphisms in this gene may increase the risk of type 2 diabetes. A pseudogene of this gene is located on the long arm of chromosome 5.

Pathways: AMPK Signaling, Carbohydrate Homeostasis