CRTC2 antibody

Catalog No. ABIN5708213

Product Details anti-CRTC2 Antibody

Target: CRTC2 (CREB Regulated Transcription Coactivator 2 (CRTC2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRTC2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids EKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTR were used as the immunogen for the TORC2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the TORC2 antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the TORC2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for CRTC2

Target: CRTC2 (CREB Regulated Transcription Coactivator 2 (CRTC2))

Alternative Name: TORC2 / CRTC2 (CRTC2 Products)

Synonyms: CRTC2 antibody, TORC-2 antibody, TORC2 antibody, 4632407F12Rik antibody, Torc2 antibody, mTORC2 antibody, RGD1308903 antibody, CREB regulated transcription coactivator 2 antibody, CRTC2 antibody, Crtc2 antibody

Background: TORC2 (Transducer of CREB protein 2), also known as CRTC2, is a protein which in humans is encoded by the CRTC2 gene. This gene encodes a member of the transducers of regulated cAMP response element-binding protein activity family of transcription coactivators. These proteins promote the transcription of genes targeted by the cAMP response element-binding protein, and therefore play an important role in many cellular processes. Under basal conditions the encoded protein is phosphorylated by AMP-activated protein kinase or the salt-inducible kinases and is sequestered in the cytoplasm. Upon activation by elevated cAMP or calcium, the encoded protein translocates to the nucleus and increases target gene expression. Single nucleotide polymorphisms in this gene may increase the risk of type 2 diabetes. A pseudogene of this gene is located on the long arm of chromosome 5.

UniProt: Q53ET0

Pathways: AMPK Signaling, Carbohydrate Homeostasis