RUNX2 antibody (Middle Region)

Catalog No. ABIN629583

Product Details anti-RUNX2 Antibody

Target: RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RUNX2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RUNX2 antibody was raised against the middle region of RUNX2

Purification: Purified

Immunogen: RUNX2 antibody was raised using the middle region of RUNX2 corresponding to a region with amino acids DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RUNX2 Blocking Peptide, catalog no. 33R-2188, is also available for use as a blocking control in assays to test for specificity of this RUNX2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RUNX2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RUNX2

Target: RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))

Alternative Name: RUNX2 (RUNX2 Products)

Synonyms: AML3 antibody, CBF-alpha-1 antibody, CBFA1 antibody, CCD antibody, CCD1 antibody, CLCD antibody, OSF-2 antibody, OSF2 antibody, PEA2aA antibody, PEBP2aA antibody, Cbf antibody, Cbfa-1 antibody, Cbfa1 antibody, LS3 antibody, Osf2 antibody, Pebp2a1 antibody, Pebpa2a antibody, runx2 antibody, RUNX2 antibody, ccd antibody, aml3 antibody, ccd1 antibody, osf2 antibody, cbfa1 antibody, pea2aa antibody, pebp2a1 antibody, pebp2a2 antibody, pebp2aa antibody, pebp2aa1 antibody, runt related transcription factor 2 antibody, runt-related transcription factor 2a antibody, runt-related transcription factor 2 antibody, runt related transcription factor 2 L homeolog antibody, RUNX2 antibody, runx2a antibody, Runx2 antibody, runx2 antibody, LOC703331 antibody, LOC100549663 antibody, runx2.L antibody

Background: RUNX2 is a member of the RUNX family of transcription factors and encodes a nuclear protein with an Runt DNA-binding domain. This protein is essential for osteoblastic differentiation and skeletal morphogenesis, acting as a scaffold for nucleic acids and regulatory factors involved in skeletal gene expression. The protein can bind DNA both as a monomer or, with more affinity, as a subunit of a heterodimeric complex. Mutations in this gene have been associated with the bone development disorder cleidocranial dysplasia (CCD). Transcript variants, encoding different protein isoforms, result from alternate promoter use as well as alternate splicing.

Molecular Weight: 57 kDa (MW of target protein)