GRIK2 antibody (N-Term)
-
- Target See all GRIK2 Antibodies
- GRIK2 (Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GRIK2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GRIK2 antibody was raised against the N terminal of GRIK2
- Purification
- Purified
- Immunogen
- GRIK2 antibody was raised using the N terminal of GRIK2 corresponding to a region with amino acids LSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLP
- Top Product
- Discover our top product GRIK2 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GRIK2 Blocking Peptide, catalog no. 33R-5447, is also available for use as a blocking control in assays to test for specificity of this GRIK2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIK2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GRIK2 (Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2))
- Alternative Name
- GRIK2 (GRIK2 Products)
- Synonyms
- GRIK5 antibody, eaa4 antibody, glr6 antibody, gluk6 antibody, glur6 antibody, grik2 antibody, mrt6 antibody, GluR6 antibody, grik2-A antibody, EAA4 antibody, GLR6 antibody, GLUK6 antibody, GLUR6 antibody, GluK2 antibody, MRT6 antibody, AW124492 antibody, Glur-6 antibody, Glur6 antibody, Glurbeta2 antibody, GRIK2 antibody, glutamate ionotropic receptor kainate type subunit 2 antibody, glutamate receptor, ionotropic, kainate 2 L homeolog antibody, glutamate receptor, ionotropic, kainate 2 antibody, glutamate receptor, ionotropic, kainate 2 (beta 2) antibody, GRIK2 antibody, grik2.L antibody, grik2 antibody, Grik2 antibody
- Background
- GRIK2 encodes a subunit of a kainate glutamate receptor. Glutamate receptors mediate the majority of excitatory neurotransmission in the brain. This receptor may have a role in synaptic plasticity and may be important for learning and memory. It also may be involved in the transmission of light information from the retina to the hypothalamus.
- Molecular Weight
- 98 kDa (MW of target protein)
- Pathways
- Synaptic Membrane, Regulation of long-term Neuronal Synaptic Plasticity
-