GNAI1 antibody

Catalog No. ABIN630620

Product Details anti-GNAI1 Antibody

Target: GNAI1 (Guanine Nucleotide Binding Protein (G Protein), alpha Inhibiting Activity Polypeptide 1 (GNAI1))

Reactivity: Human, Mouse, Rat, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GNAI1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GNAI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GNAI1 Blocking Peptide, catalog no. 33R-10215, is also available for use as a blocking control in assays to test for specificity of this GNAI1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GNAI1

Target: GNAI1 (Guanine Nucleotide Binding Protein (G Protein), alpha Inhibiting Activity Polypeptide 1 (GNAI1))

Alternative Name: GNAI1 (GNAI1 Products)

Synonyms: AU046200 antibody, Gialpha1 antibody, Gnai-1 antibody, gnai1 antibody, Gi antibody, BPGTPB antibody, zgc:63957 antibody, guanine nucleotide binding protein (G protein), alpha inhibiting 1 antibody, G protein subunit alpha i1 antibody, guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 S homeolog antibody, guanine nucleotide-binding protein G(i) subunit alpha-1 antibody, guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 antibody, Gnai1 antibody, gnai1.S antibody, GNAI1 antibody, LOC397505 antibody, gnai1 antibody

Background: Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase, Go, a protein abundant in brain (GNAO1), and transducin-1 (GNAT1) and transducin-2 (GNAT2), proteins involved in phototransduction in retinal rods and cones, respectively.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: G-protein mediated Events