SDHB antibody

Catalog No. ABIN631009

Product Details anti-SDHB Antibody

Target: SDHB (Succinate Dehydrogenase Complex, Subunit B, Iron Sulfur (Ip) (SDHB))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SDHB antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SDHB antibody was raised using a synthetic peptide corresponding to a region with amino acids YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SDHB Blocking Peptide, catalog no. 33R-10234, is also available for use as a blocking control in assays to test for specificity of this SDHB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDHB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SDHB

Target: SDHB (Succinate Dehydrogenase Complex, Subunit B, Iron Sulfur (Ip) (SDHB))

Alternative Name: SDHB (SDHB Products)

Synonyms: succinate dehydrogenase 2-3 antibody, CG3283 antibody, Dmel\\CG3283 antibody, Ip antibody, SDH antibody, SDH-IP antibody, SDH-Ip antibody, SDHb antibody, sdhB antibody, CWS2 antibody, IP antibody, PGL4 antibody, SDH1 antibody, SDH2 antibody, SDHIP antibody, 0710008N11Rik antibody, fj46d06 antibody, wu:fj46d06 antibody, succinate dehydrogenase complex iron sulfur subunit B antibody, succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3 antibody, Succinate dehydrogenase, subunit B (iron-sulfur) antibody, succinate dehydrogenase complex subunit B, iron sulfur (Ip) antibody, succinate dehydrogenase complex, subunit B, iron sulfur (Ip) antibody, succinate dehydrogenase complex subunit B, iron sulfur (Ip) S homeolog antibody, SDHB antibody, SDH2-3 antibody, SdhB antibody, sdhb antibody, Sdhb antibody, sdhb.S antibody

Background: Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis.

Molecular Weight: 31 kDa (MW of target protein)