TINF2 antibody

Catalog No. ABIN631193

Product Details anti-TINF2 Antibody

Target: TINF2 (TIN2) (TERF1 Interacting Nuclear Factor 2 (TIN2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TINF2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: TINF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDEEENGQGEGKESLENYQKTKFDTLIPTLCEYLPPSGHGAIPVSSCDCR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TINF2 Blocking Peptide, catalog no. 33R-8348, is also available for use as a blocking control in assays to test for specificity of this TINF2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TINF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TINF2

Target: TINF2 (TIN2) (TERF1 Interacting Nuclear Factor 2 (TIN2))

Alternative Name: TINF2 (TIN2 Products)

Synonyms: DKCA3 antibody, TIN2 antibody, AW552114 antibody, D14Wsu146e antibody, Tin2 antibody, TERF1 interacting nuclear factor 2 antibody, Terf1 (TRF1)-interacting nuclear factor 2 antibody, TINF2 antibody, Tinf2 antibody

Background: TINF2 is a component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends, without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. It plays a role in shelterin complex assembly.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Cell Division Cycle, Telomere Maintenance, Regulation of Carbohydrate Metabolic Process