PIAS2 antibody (N-Term)

Catalog No. ABIN631219

Product Details anti-PIAS2 Antibody

Target: PIAS2 (Protein Inhibitor of Activated STAT, 2 (PIAS2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIAS2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PIAS2 antibody was raised against the N terminal of PIAS2

Purification: Affinity purified

Immunogen: PIAS2 antibody was raised using the N terminal of PIAS2 corresponding to a region with amino acids RELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIAS2 Blocking Peptide, catalog no. 33R-7881, is also available for use as a blocking control in assays to test for specificity of this PIAS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIAS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIAS2

Target: PIAS2 (Protein Inhibitor of Activated STAT, 2 (PIAS2))

Alternative Name: PIAS2 (PIAS2 Products)

Synonyms: MGC83751 antibody, piasx antibody, wu:fi05f09 antibody, PIAS2 antibody, 6330408K17Rik antibody, AI462206 antibody, ARIP3 antibody, AU018068 antibody, Dib antibody, Miz1 antibody, PIASxalpha antibody, PIASxb antibody, PIASxbeta antibody, SIZ2 antibody, DIP antibody, MIZ antibody, MIZ1 antibody, PIASX antibody, PIASX-ALPHA antibody, PIASX-BETA antibody, ZMIZ4 antibody, protein inhibitor of activated STAT 2 L homeolog antibody, protein inhibitor of activated STAT 2 antibody, protein inhibitor of activated STAT, 2 antibody, pias2.L antibody, PIAS2 antibody, pias2 antibody, Pias2 antibody

Background: Pias2 functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. It plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway.

Molecular Weight: 63 kDa (MW of target protein)

Pathways: JAK-STAT Signaling, Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling