PIAS2 antibody (N-Term)
-
- Target See all PIAS2 Antibodies
- PIAS2 (Protein Inhibitor of Activated STAT, 2 (PIAS2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PIAS2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PIAS2 antibody was raised against the N terminal of PIAS2
- Purification
- Affinity purified
- Immunogen
- PIAS2 antibody was raised using the N terminal of PIAS2 corresponding to a region with amino acids RELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPST
- Top Product
- Discover our top product PIAS2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PIAS2 Blocking Peptide, catalog no. 33R-7881, is also available for use as a blocking control in assays to test for specificity of this PIAS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIAS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PIAS2 (Protein Inhibitor of Activated STAT, 2 (PIAS2))
- Alternative Name
- PIAS2 (PIAS2 Products)
- Synonyms
- MGC83751 antibody, piasx antibody, wu:fi05f09 antibody, PIAS2 antibody, 6330408K17Rik antibody, AI462206 antibody, ARIP3 antibody, AU018068 antibody, Dib antibody, Miz1 antibody, PIASxalpha antibody, PIASxb antibody, PIASxbeta antibody, SIZ2 antibody, DIP antibody, MIZ antibody, MIZ1 antibody, PIASX antibody, PIASX-ALPHA antibody, PIASX-BETA antibody, ZMIZ4 antibody, protein inhibitor of activated STAT 2 L homeolog antibody, protein inhibitor of activated STAT 2 antibody, protein inhibitor of activated STAT, 2 antibody, pias2.L antibody, PIAS2 antibody, pias2 antibody, Pias2 antibody
- Background
- Pias2 functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. It plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway.
- Molecular Weight
- 63 kDa (MW of target protein)
- Pathways
- JAK-STAT Signaling, Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling
-