CRBN antibody (N-Term)
-
- Target See all CRBN Antibodies
- CRBN (Cereblon (CRBN))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CRBN antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CRBN antibody was raised against the N terminal of CRBN
- Purification
- Affinity purified
- Immunogen
- CRBN antibody was raised using the N terminal of CRBN corresponding to a region with amino acids DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL
- Top Product
- Discover our top product CRBN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CRBN Blocking Peptide, catalog no. 33R-2125, is also available for use as a blocking control in assays to test for specificity of this CRBN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRBN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CRBN (Cereblon (CRBN))
- Alternative Name
- CRBN (CRBN Products)
- Synonyms
- zgc:92404 antibody, mrt2a antibody, F3N11.21 antibody, MRT2 antibody, MRT2A antibody, 2610203G15Rik antibody, 2900045O07Rik antibody, AF229032 antibody, AW108261 antibody, piL antibody, cereblon antibody, ATP-dependent protease La (LON) domain protein antibody, crbn antibody, CRBN antibody, AT2G25740 antibody, Crbn antibody
- Background
- This gene encodes a protein related to the Lon protease protein family. In rodents and other mammals this gene product is found in the cytoplasm localized with a calcium channel membrane protein, and is thought to play a role in brain development.
- Molecular Weight
- 50 kDa (MW of target protein)
-