HGF antibody
-
- Target See all HGF Antibodies
- HGF (Hepatocyte Growth Factor (Hepapoietin A, Scatter Factor) (HGF))
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HGF antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- HGF antibody was raised using a synthetic peptide corresponding to a region with amino acids VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP
- Top Product
- Discover our top product HGF Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HGF Blocking Peptide, catalog no. 33R-9625, is also available for use as a blocking control in assays to test for specificity of this HGF antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HGF antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HGF (Hepatocyte Growth Factor (Hepapoietin A, Scatter Factor) (HGF))
- Alternative Name
- HGF (HGF Products)
- Synonyms
- DFNB39 antibody, F-TCF antibody, HGFB antibody, HPTA antibody, SF antibody, HGF antibody, C230052L06Rik antibody, HGF/SF antibody, NK1 antibody, NK2 antibody, SF/HGF antibody, hepatocyte growth factor antibody, HGF antibody, Hgf antibody
- Background
- Hepatocyte growth factor regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. Hepatocyte growth factor is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration.
- Molecular Weight
- 79 kDa (MW of target protein)
- Pathways
- RTK Signaling, Carbohydrate Homeostasis, Glycosaminoglycan Metabolic Process, Synaptic Membrane, Signaling of Hepatocyte Growth Factor Receptor
-