IL28RA antibody
-
- Target See all IL28RA Antibodies
- IL28RA (Interleukin 28 Receptor, alpha (Interferon, lambda Receptor) (IL28RA))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IL28RA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- IL28 R alpha antibody was raised using a synthetic peptide corresponding to a region with amino acids EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF
- Top Product
- Discover our top product IL28RA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IL28R alpha Blocking Peptide, catalog no. 33R-2338, is also available for use as a blocking control in assays to test for specificity of this IL28R alpha antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL20 A antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IL28RA (Interleukin 28 Receptor, alpha (Interferon, lambda Receptor) (IL28RA))
- Alternative Name
- IL28R alpha (IL28RA Products)
- Synonyms
- IFNLR1 antibody, IL28RA antibody, crf2/12 antibody, ifnlr antibody, il-28r1 antibody, il28ra antibody, licr2 antibody, ifnlr1 antibody, CRF2-12 antibody, Il28ra antibody, CRF2/12 antibody, IFNLR antibody, IL-28R1 antibody, LICR2 antibody, RGD1562689 antibody, interferon lambda receptor 1 antibody, interferon, lambda receptor 1 antibody, interferon, lambda receptor 1 L homeolog antibody, IFNLR1 antibody, ifnlr1 antibody, ifnlr1.L antibody, Ifnlr1 antibody
- Background
- IL28RA belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B.
- Molecular Weight
- 54 kDa (MW of target protein)
-