anti-Mouse (Murine) JAG2 antibody for Western Blotting

Recommended JAG2 Antibody (supplied by: Log in to see )

Antigen
Jagged 2 (JAG2) Antibodies
  • D12Ggc2e
  • Serh
  • mJagged2-1
  • sm
  • HJ2
  • SER2
  • jag2
  • serB
  • zgc:152855
  • jagged 2
  • jagged 2b
  • JAG2
  • jag2
  • Jag2
  • jag2b
Epitope
N-Term
10
9
7
5
5
4
4
4
3
2
2
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
83
54
29
2
2
2
Host
Rabbit
73
20
10
8
Clonality
Polyclonal
Conjugate
This JAG2 antibody is un-conjugated
6
6
6
4
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
63
41
32
21
13
10
7
4
4
3
3
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN634269
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
13.806385 ABIN1859519 ICC IHC WB Rabbit IgG AA 709-941 Log in to see Polyclonal 0
13.806385 ABIN2935975 IF/ICC IHC IP WB Rabbit AA 709-941 Log in to see Polyclonal 0
13.25679 ABIN6389903 ELISA WB Rabbit IgG Log in to see Polyclonal 0
13.25679 ABIN129632 IHC ELISA WB Rabbit IgG AA 111-128 Log in to see Polyclonal 0
12.306385 ABIN2782165 IHC WB Rabbit N-Term Log in to see Polyclonal 2
4.8063846 ABIN6262698 ELISA WB Rabbit IgG Log in to see Polyclonal 0
4.8063846 ABIN2458924 ELISA WB Rabbit Log in to see Polyclonal 0
4 ABIN320920 WB Rabbit IgG N-Term Log in to see Polyclonal 0
1 ABIN705800 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal 0
1 ABIN2610944 WB Rabbit IgG AA 709-941 Log in to see Polyclonal 0
1 ABIN705793 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal 0
1 ABIN2610948 WB FITC Rabbit IgG AA 709-941 Log in to see Polyclonal 0
1 ABIN2610946 WB Biotin Rabbit IgG AA 709-941 Log in to see Polyclonal 0
1 ABIN705791 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal 0
1 ABIN2292988 ELISA WB Rabbit IgG AA 111-128 Log in to see Polyclonal 0
1 ABIN6291337 WB Rabbit IgG Log in to see Polyclonal 0
-11.02447 ABIN4327860 ELISA WB Rabbit Log in to see Polyclonal 0

General

Antigen Jagged 2 (JAG2) Antibodies
Epitope N-Term
(10), (9), (7), (5), (5), (4), (4), (4), (3), (2), (2), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(83), (54), (29), (2), (2), (2)
Host Rabbit
(73), (20), (10), (8)
Clonality
Polyclonal
Conjugate This JAG2 antibody is un-conjugated
(6), (6), (6), (4), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(63), (41), (32), (21), (13), (10), (7), (4), (4), (3), (3), (2), (1)
Supplier Log in to see

Product Details anti-JAG2 Antibody

Target Details JAG2 Application Details Handling Images
Specificity Jagged 2 antibody was raised against the N terminal of JAG2
Purification Affinity purified
Immunogen Jagged 2 antibody was raised using the N terminal of JAG2 corresponding to a region with amino acids RAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCD
Plasmids, Primers & others

Target Details JAG2

Product Details anti-JAG2 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Jagged 2 (JAG2 Antibody Abstract)
Background The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch protein family are transmembrane receptors that are critical for various cell fate decisions. JAG2 is one of several ligands that activate Notch and related receptors. The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions.
Molecular Weight 130 kDa (MW of target protein)
Pathways Notch Signaling, Sensory Perception of Sound

Application Details

Product Details anti-JAG2 Antibody Target Details JAG2 Handling Images back to top
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

Jagged 2 Blocking Peptide, catalog no. 33R-7820, is also available for use as a blocking control in assays to test for specificity of this Jagged 2 antibody

Restrictions For Research Use only

Handling

Product Details anti-JAG2 Antibody Target Details JAG2 Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JAG2 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Product Details anti-JAG2 Antibody Target Details JAG2 Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Jagged 2 (JAG2) (N-Term) antibody (ABIN634269) Jagged 2 antibody used at 1 ug/ml to detect target protein.