anti-Human Manic Fringe antibody for Western Blotting

Recommended Manic Fringe Antibody (supplied by: Log in to see )

MFNG Antibodies
  • AW546563
  • MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  • MFNG
  • Mfng
Middle Region
Human, Mouse (Murine), Rat (Rattus)
This Manic Fringe antibody is un-conjugated
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN633860
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
15.531807 ABIN633865 WB Rabbit C-Term Log in to see Polyclonal 0
11.834636 ABIN3185449 ELISA WB Rabbit IgG Internal Region Log in to see Polyclonal 0
11.834636 ABIN5618247 ELISA WB Rabbit IgG Log in to see Polyclonal 0
7.697171 ABIN6258883 ELISA ICC IF WB Rabbit IgG Log in to see Polyclonal 0
7.697171 ABIN1859809 ICC IHC WB Rabbit IgG AA 80-316 Log in to see Polyclonal 0
7.697171 ABIN561813 ELISA WB Mouse AA 214-291 Log in to see Polyclonal 0
7.697171 ABIN2909665 IF/ICC IHC IP WB Rabbit AA 80-316 Log in to see Polyclonal 0
7.697171 ABIN1850904 ELISA WB Rabbit Internal Region Log in to see Polyclonal 0
7 ABIN1913324 IHC IHC (p) WB Rabbit IgG C-Term Log in to see Polyclonal 0
7 ABIN517896 ELISA WB Mouse IgG2a kappa AA 214-291 Log in to see 2B11 0
4.697171 ABIN2783425 WB Rabbit Middle Region Log in to see Polyclonal 1
4.697171 ABIN2783426 WB Rabbit C-Term Log in to see Polyclonal 1
4.697171 ABIN2782201 WB Rabbit Middle Region Log in to see Polyclonal 0
4.697171 ABIN3222780 WB Rabbit Log in to see Polyclonal 0
4.697171 ABIN517894 WB Mouse AA 1-321 Log in to see Polyclonal 0
4.697171 ABIN2463195 ELISA WB Rabbit Log in to see Polyclonal 0
4.697171 ABIN2463196 ELISA WB Rabbit Log in to see Polyclonal 0
4.697171 ABIN517895 WB Mouse AA 1-321 Log in to see Polyclonal 0
4.697171 ABIN6711155 WB Rabbit AA 66-110 Log in to see Polyclonal 0
4 ABIN1913322 IHC IHC (p) WB Rabbit IgG AA 211-260 Log in to see Polyclonal 0


Antigen MFNG Antibodies
Epitope Middle Region
(5), (4), (4), (4), (4), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(56), (32), (32), (6), (6), (5), (5), (5), (3), (2), (2), (2), (1), (1)
Host Rabbit
(49), (9), (2)
Conjugate This Manic Fringe antibody is un-conjugated
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(46), (17), (13), (9), (6), (4), (4), (3), (1)
Supplier Log in to see

Product Details anti-Manic Fringe Antibody

Target Details Manic Fringe Application Details Handling Images
Specificity MFNG antibody was raised against the middle region of MFNG
Purification Affinity purified
Immunogen MFNG antibody was raised using the middle region of MFNG corresponding to a region with amino acids MAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETL

Target Details Manic Fringe

Product Details anti-Manic Fringe Antibody Application Details Handling Images back to top
Alternative Name MFNG (MFNG Antibody Abstract)
Background MFNG is one of the evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. This gene is a member of the fringe gene family which also includes Radical and Lunatic fringe. They all encode evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta1,3 N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling.
Molecular Weight 36 kDa (MW of target protein)
Pathways Notch Signaling

Application Details

Product Details anti-Manic Fringe Antibody Target Details Manic Fringe Handling Images back to top
Application Notes WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

MFNG Blocking Peptide, catalog no. 33R-5720, is also available for use as a blocking control in assays to test for specificity of this MFNG antibody

Restrictions For Research Use only


Product Details anti-Manic Fringe Antibody Target Details Manic Fringe Application Details Images back to top
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFNG antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Product Details anti-Manic Fringe Antibody Target Details Manic Fringe Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-MFNG (MFNG) (Middle Region) antibody (ABIN633860) MFNG antibody used at 0.25 ug/ml to detect target protein.