anti-Mouse (Murine) DPP4 antibody for Immunocytochemistry

Recommended DPP4 Antibody (supplied by: Log in to see )

Antigen
Dipeptidyl-Peptidase 4 (DPP4) Antibodies
  • ADABP
  • ADCP2
  • CD26
  • DPPIV
  • TP103
  • MGC81966
  • MOP9.8
  • MOP9_8
  • DPP4
  • si:ch73-2d23.3
  • Cd26
  • Dpp-4
  • THAM
  • dipeptidyl peptidase 4
  • dipeptidyl-peptidase 4 S homeolog
  • prolyl oligopeptidase family protein
  • dipeptidyl-peptidase 4
  • dipeptidylpeptidase 4
  • DPP4
  • dpp4.S
  • AT5G24260
  • dpp4
  • Dpp4
Reactivity
Human, Mouse (Murine), Rat (Rattus)
527
191
122
28
18
14
9
7
6
5
5
5
4
3
2
2
2
2
1
1
1
Host
Chicken
429
161
92
23
4
Clonality
Polyclonal
Conjugate
This DPP4 antibody is un-conjugated
62
61
52
32
16
16
15
14
13
13
9
9
9
9
9
8
6
6
5
5
5
5
5
5
4
3
3
3
3
3
3
3
3
3
3
3
3
3
3
2
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
485
188
165
136
109
98
69
39
16
13
13
10
8
6
6
4
4
3
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4306062
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1173875 ICC IHC WB Rabbit IgG AA 29-178 Log in to see Polyclonal 0
1 ABIN1858663 ICC IHC WB Rabbit IgG AA 631-760 Log in to see Polyclonal 0
1 ABIN2467804 ICC Chicken AA 547-610 Log in to see Polyclonal 0

General

Antigen Dipeptidyl-Peptidase 4 (DPP4) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(527), (191), (122), (28), (18), (14), (9), (7), (6), (5), (5), (5), (4), (3), (2), (2), (2), (2), (1), (1), (1)
Host Chicken
(429), (161), (92), (23), (4)
Clonality
Polyclonal
Conjugate This DPP4 antibody is un-conjugated
(62), (61), (52), (32), (16), (16), (15), (14), (13), (13), (9), (9), (9), (9), (9), (8), (6), (6), (5), (5), (5), (5), (5), (5), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
(485), (188), (165), (136), (109), (98), (69), (39), (16), (13), (13), (10), (8), (6), (6), (4), (4), (3), (2), (1), (1)
Supplier Log in to see

Product Details anti-DPP4 Antibody

Target Details DPP4 Application Details Handling Images
Specificity CD26
Purification Immunogen affinity purified
Immunogen Synthetic peptide: YAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTFEVEDQIEAA, corresponding to amino acids 547-610 of Human CD26.
Plasmids, Primers & others

Target Details DPP4

Product Details anti-DPP4 Antibody Application Details Handling Images back to top
Antigen
Alternative Name DPPIV/CD26 (DPP4 Antibody Abstract)
Background Gene Symbol: DPP4
Gene ID 1803
Pathways Peptide Hormone Metabolism, Regulation of Leukocyte Mediated Immunity

Application Details

Product Details anti-DPP4 Antibody Target Details DPP4 Handling Images back to top
Application Notes Western Blot 1:100-1:2000, Immunocytochemistry/Immunofluorescence 1:10-1:500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-DPP4 Antibody Target Details DPP4 Application Details Images back to top
Format Liquid
Concentration 1.0 mg/mL
Buffer PBS
Buffer contains: No Preservative
Preservative Without preservative
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-DPP4 Antibody Target Details DPP4 Application Details Handling back to top
Supplier Images
Immunocytochemistry (ICC) image for anti-Dipeptidyl-Peptidase 4 (DPP4) antibody (ABIN4306062) Immunocytochemistry: DPPIV/CD26 Antibody [ABIN43060628] - CD26 Antibody [ABIN43060628...