anti-Rat (Rattus) Mediterranean Fever antibody for Western Blotting

Recommended Mediterranean Fever Antibody (supplied by: Log in to see )

Mediterranean Fever (MEFV) Antibodies
  • pyrin
  • MEFV
  • FMF
  • MEF
  • TRIM20
  • rfp domain
  • MEFV, pyrin innate immunity regulator
  • Mediterranean fever
  • MEFV
  • Mefv
AA 5-39, N-Term
Human, Rat (Rattus)
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Available images

Catalog No. ABIN3042357
$ 240.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
4.842569 ABIN2779421 WB Rabbit N-Term Log in to see Polyclonal 1
4.842569 ABIN4951702 WB Rabbit IgG Log in to see Polyclonal 0


Antigen Mediterranean Fever (MEFV) Antibodies
Epitope AA 5-39, N-Term
(19), (18), (9), (5), (5), (5), (5), (1)
Reactivity Human, Rat (Rattus)
(65), (4), (3), (3), (2), (2), (2), (2), (1), (1), (1)
Host Rabbit
(43), (17), (5)
Conjugate Un-conjugated
(3), (3), (3), (3), (3), (3)
Application Western Blotting (WB)
(57), (42), (5), (4), (4), (2), (1), (1)
Supplier Log in to see

Product details

Target Details Application Details Handling Images
Purpose Rabbit IgG polyclonal antibody for Pyrin(MEFV) detection. Tested with WB in Human,Rat.
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Pyrin(MEFV) detection. Tested with WB in Human,Rat.
Gene Name: Mediterranean fever
Protein Name: Pyrin
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human MEFV(5-39aa PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR), different from the related mouse sequence by eight amino acids, and from the related rat sequence by eleven amino acids.
Isotype IgG

Target Details

Product details Application Details Handling Images back to top
Alternative Name MEFV (MEFV Antibody Abstract)
Background MEFV (Mediterranean fever) is a human gene that provides instructions for making a protein called pyrin (also known as marenostrin). Pyrin is produced in certain white blood cells (neutrophils, eosinophils and monocytes) that play a role in inflammation and in fighting infection. Inside these white blood cells, pyrin is found with thecytoskeleton, the structural framework that helps to define the shape, size, and movement of a cell. Pyrin's protein structure also allows it to interact with other molecules involved in fighting infection and in the inflammatory response. Although pyrin's function is not fully understood, it likely assists in keeping the inflammation process under control. Research indicates that pyrin helps regulate inflammation by interacting with the cytoskeleton. And Pyrin may direct the migration of white blood cells to sites of inflammation and stop or slow the inflammatory response when it is no longer needed.

Synonyms: FMF antibody|Marenostrin antibody|Mediterranean fever antibody|Mediterranean fever protein antibody|MEF antibody|Mefv antibody| MEFV_HUMAN antibody|Pyrin antibody|TRIM20 antibody
Gene ID 4210
UniProt O15553
Pathways Positive Regulation of Endopeptidase Activity

Application Details

Product details Target Details Handling Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions For Research Use only


Product details Target Details Application Details Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.


Product details Target Details Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Mediterranean Fever (MEFV) (AA 5-39), (N-Term) antibody (ABIN3042357) anti-Mediterranean Fever (MEFV) (AA 5-39), (N-Term) antibody