Integrin beta 2 antibody (N-Term)

Catalog No. ABIN3031373

Product Details anti-Integrin beta 2 Antibody

Target: Integrin beta 2 (ITGB2)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Integrin beta 2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: An amino acid sequence from the N-terminus of human CD18 (ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD) was used as the immunogen for this CD18 antibody.

Isotype: IgG

Application Details

Application Notes: The stated application concentrations are suggested starting amounts. Titration of the CD18 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the CD18 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for Integrin beta 2

Target: Integrin beta 2 (ITGB2)

Alternative Name: CD18 (ITGB2 Products)

Synonyms: CD18 antibody, LAD antibody, LCAMB antibody, LFA-1 antibody, MAC-1 antibody, MF17 antibody, MFI7 antibody, 2E6 antibody, AI528527 antibody, Cd18 antibody, Lfa1 antibody, ITGB2 antibody, itgb2 antibody, itgb2-a antibody, itgb2-b antibody, integrin subunit beta 2 antibody, integrin beta 2 antibody, integrin subunit beta 2 S homeolog antibody, ITGB2 antibody, Itgb2 antibody, itgb2.S antibody

Background: The beta-2 integrin chain gene is designated ITGB2 and the leukocyte antigen has been designated CD18. The 3 alpha integrin chains associated individually with the beta-2 chain as a heterodimer have gene designations of ITGAL, ITGAM, and ITGAX, and leukocyte antigen designations of CD11A, CD11B, and CD11C, respectively. The expression of CD18 was increased in lymphoblastoid cells from persons with Down syndrome, consistent with the location of the gene on chromosome 21. The ITGB2 gene spans approximately 40 kb and contains 16 exons and all exon/intron boundaries conform to the GT/AG splicing consensus. Furthermore, ITGB2 was constitutively clustered. Although it was expressed on the cell surface at normal levels and was capable of function following extracellular stimulation, it could not be activated via the ""inside-out"" signaling pathways.

UniProt: P05107

Pathways: NF-kappaB Signaling, Activation of Innate immune Response, Toll-Like Receptors Cascades, Activated T Cell Proliferation