Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

HRAS antibody (C-Term)

HRAS Reactivity: Mouse, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN3043845
  • Target See all HRAS Antibodies
    HRAS (HRas proto-oncogene, GTPase (HRAS))
    Binding Specificity
    • 15
    • 15
    • 13
    • 13
    • 7
    • 6
    • 5
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    AA 101-137, C-Term
    Reactivity
    • 68
    • 52
    • 37
    • 7
    • 4
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Mouse, Rat
    Host
    • 90
    • 10
    • 1
    Rabbit
    Clonality
    • 89
    • 12
    Polyclonal
    Conjugate
    • 43
    • 11
    • 10
    • 6
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    This HRAS antibody is un-conjugated
    Application
    • 91
    • 43
    • 26
    • 26
    • 16
    • 16
    • 11
    • 9
    • 7
    • 4
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Purpose
    Rabbit IgG polyclonal antibody for GTPase Hras(HRAS) detection. Tested with WB in Human,Mouse,Rat.
    Sequence
    KRVKDSDDVP MVLVGNKCDL AARTVESRQA QDLAR
    Cross-Reactivity (Details)
    Predicted Cross Reactivity: human
    No cross reactivity with other proteins.
    Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.
    Characteristics
    Rabbit IgG polyclonal antibody for GTPase Hras(HRAS) detection. Tested with WB in Human,Mouse,Rat.
    Gene Name: Harvey rat sarcoma viral oncogene homolog
    Protein Name: GTPase Hras
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human GTPase HRAS (101-137aa KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR SY), identical to the related mouse and rat sequences.
    Isotype
    IgG
    Top Product
    Discover our top product HRAS Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
    Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Handling Advice
    Avoid repeated freezing and thawing.
    Storage
    4 °C/-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Target
    HRAS (HRas proto-oncogene, GTPase (HRAS))
    Alternative Name
    HRAS (HRAS Products)
    Synonyms
    C-BAS/HAS antibody, C-H-RAS antibody, C-HA-RAS1 antibody, CTLO antibody, H-RASIDX antibody, HAMSV antibody, HRAS1 antibody, K-RAS antibody, N-RAS antibody, RASH1 antibody, hras antibody, zgc:110250 antibody, HRAS antibody, H-RAS antibody, c-H-ras antibody, H-Ras antibody, K-Ras antibody, hras1 antibody, rash1 antibody, ras antibody, N-Ras antibody, c-bas/has antibody, H-ras antibody, Ha-ras antibody, Harvey-ras antibody, Hras-1 antibody, Kras2 antibody, c-Ha-ras antibody, c-rasHa antibody, hrasl antibody, zgc:110734 antibody, HRas proto-oncogene, GTPase antibody, v-Ha-ras Harvey rat sarcoma viral oncogene homolog a antibody, neuroblastoma RAS viral (v-ras) oncogene homolog pseudogene antibody, Harvey rat sarcoma viral oncogene homolog L homeolog antibody, Harvey rat sarcoma viral oncogene homolog antibody, Harvey rat sarcoma virus oncogene antibody, NRAS proto-oncogene, GTPase antibody, -Ha-ras Harvey rat sarcoma viral oncogene homolog b antibody, HRAS antibody, hrasa antibody, LOC733587 antibody, Hras antibody, hras.L antibody, hras antibody, NRAS antibody, hrasb antibody
    Background
    GTPase HRas, also known as transforming protein p21, is an enzyme that in humans is encoded by the HRAS gene. This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, mental retardation, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene.

    Synonyms: C BAS/HAS antibody|c H ras antibody|C HA RAS1 antibody|c has/bas p21 protein antibody|c ras Ki 2 activated oncogene antibody|c-H-ras antibody|CTLO antibody|GTP and GDP binding peptide B antibody|GTPase HRas, N-terminally processed antibody|H Ras 1 antibody|H RASIDX antibody|H-Ras-1 antibody|Ha Ras antibody|Ha Ras1 proto oncoprotein antibody|Ha-Ras antibody|HAMSV antibody|Harvey rat sarcoma viral oncogene homolog antibody|Harvey rat sarcoma viral oncoprotein antibody|HRAS antibody|HRAS1 antibody|K ras antibody|N ras antibody|p19 H RasIDX protein antibody|p21ras antibody|Ras family small GTP binding protein H Ras antibody|RASH_HUMAN antibody|RASH1 antibody| Transformation gene oncogene HAMSV antibody|Transforming protein p21 antibody|v Ha ras Harvey rat sarcoma viral oncogene homolog antibody|VH Ras antibody|vHa RAS antibody
    Gene ID
    3265
    UniProt
    P01112
    Pathways
    p53 Signaling, MAPK Signaling, RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Hepatitis C, Autophagy, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, Regulation of long-term Neuronal Synaptic Plasticity, VEGF Signaling, BCR Signaling
You are here:
Support