Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

HRAS antibody

HRAS Reactivity: Human, Mouse, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN4951352
  • Target See all HRAS Antibodies
    HRAS (HRas proto-oncogene, GTPase (HRAS))
    Reactivity
    • 67
    • 52
    • 37
    • 7
    • 4
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 89
    • 10
    • 1
    Rabbit
    Clonality
    • 89
    • 11
    Polyclonal
    Conjugate
    • 42
    • 11
    • 10
    • 6
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    This HRAS antibody is un-conjugated
    Application
    • 90
    • 43
    • 26
    • 26
    • 16
    • 15
    • 10
    • 9
    • 7
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Purification
    Antigen affinity
    Immunogen
    Amino acids KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSY of human HRAS were used as the immunogen for the HRAS antibody.
    Isotype
    IgG
    Top Product
    Discover our top product HRAS Primary Antibody
  • Application Notes
    Optimal dilution of the HRAS antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
    Restrictions
    For Research Use only
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Storage
    -20 °C
    Storage Comment
    After reconstitution, the HRAS antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target
    HRAS (HRas proto-oncogene, GTPase (HRAS))
    Alternative Name
    HRAS (HRAS Products)
    Synonyms
    C-BAS/HAS antibody, C-H-RAS antibody, C-HA-RAS1 antibody, CTLO antibody, H-RASIDX antibody, HAMSV antibody, HRAS1 antibody, K-RAS antibody, N-RAS antibody, RASH1 antibody, hras antibody, zgc:110250 antibody, HRAS antibody, H-RAS antibody, c-H-ras antibody, H-Ras antibody, K-Ras antibody, hras1 antibody, rash1 antibody, ras antibody, N-Ras antibody, c-bas/has antibody, H-ras antibody, Ha-ras antibody, Harvey-ras antibody, Hras-1 antibody, Kras2 antibody, c-Ha-ras antibody, c-rasHa antibody, hrasl antibody, zgc:110734 antibody, HRas proto-oncogene, GTPase antibody, v-Ha-ras Harvey rat sarcoma viral oncogene homolog a antibody, neuroblastoma RAS viral (v-ras) oncogene homolog pseudogene antibody, Harvey rat sarcoma viral oncogene homolog L homeolog antibody, Harvey rat sarcoma viral oncogene homolog antibody, Harvey rat sarcoma virus oncogene antibody, NRAS proto-oncogene, GTPase antibody, -Ha-ras Harvey rat sarcoma viral oncogene homolog b antibody, HRAS antibody, hrasa antibody, LOC733587 antibody, Hras antibody, hras.L antibody, hras antibody, NRAS antibody, hrasb antibody
    Background
    GTPase HRas, also known as transforming protein p21, is an enzyme that in humans is encoded by the HRAS gene. This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, mental retardation, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene.
    UniProt
    P01112
    Pathways
    p53 Signaling, MAPK Signaling, RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Hepatitis C, Autophagy, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, Regulation of long-term Neuronal Synaptic Plasticity, VEGF Signaling, BCR Signaling
Support