anti-Rat (Rattus) STAT1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended STAT1 Antibody

Antigen
Signal Transducer and Activator of Transcription 1, 91kDa (STAT1) Antibodies
  • CANDF7
  • ISGF-3
  • STAT91
  • 2010005J02Rik
  • AA408197
  • XStat1
  • STAT4
  • DD6G4-4
  • STAT
  • STAT1
  • dZ182H3.3
  • si:by134g18.2
  • si:by51f19.1
  • si:dz182h3.3
  • si:dz199m19.1
  • si:dz73o4.2
  • stat1
  • signal transducer and activator of transcription 1
  • signal transducer and activator of transcription 1 L homeolog
  • signal transducer and activator of transcription 1, 91kDa
  • signal transducer and activator of transcription 4
  • signal transducer and activator of transcription 1a
  • STAT1
  • Stat1
  • stat1.L
  • stat4
  • stat1a
Epitope
AA 114-143, N-Term
103
75
52
18
17
15
9
8
8
8
7
6
6
6
5
5
4
4
4
3
3
3
3
3
3
3
3
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
556
302
269
33
29
26
22
22
16
13
11
7
7
5
2
2
2
1
1
1
1
1
Host
Rabbit
477
108
2
1
1
Clonality
Polyclonal
Conjugate
This STAT1 antibody is un-conjugated
19
15
12
10
10
10
10
10
10
6
6
4
4
4
4
4
4
2
2
2
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
453
209
165
110
90
52
48
18
17
9
7
6
5
3
1
1
Options

Available images

Catalog No. ABIN3043938
$ 280.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Clonality References Details
14.585577 ABIN214518 ICC IHC IHC (p) IP WB Rabbit IgG C-Term Polyclonal 0
14.585577 ABIN5611535 EIA IHC (p) WB Rabbit IgG C-Term Polyclonal 0
14.585577 ABIN5611519 EIA IHC (p) WB Rabbit IgG pSer727 Polyclonal 0
13.592318 ABIN4902308 IHC (p) Mouse IgG1 AA 640-720 8H11 0
13.592318 ABIN4902309 IHC (p) Mouse IgG1 AA 640-720 12E8 0
13.592318 ABIN4902310 IHC (p) Mouse IgG1 AA 640-720 5H7 0
13.592318 ABIN1689931 IHC (p) WB Rabbit Polyclonal 0
13.085577 ABIN674889 IF (p) IHC (p) WB Rabbit IgG Polyclonal 3
13.085577 ABIN732623 IF (p) IHC (p) WB Rabbit IgG pTyr701 Polyclonal 1
11.585577 ABIN498804 IHC (p) WB Rabbit pSer727 Polyclonal 0
11.585577 ABIN498895 IHC (p) WB Rabbit Polyclonal 0
11.5 ABIN5518871 IHC (p) WB Rabbit IgG AA 2-230 Polyclonal 2
10 ABIN6652217 IF IHC (p) WB Rabbit pSer727 Polyclonal 4
10 ABIN4952710 IHC (p) WB Rabbit IgG Polyclonal 0
8.585577 ABIN1109148 IHC (p) WB Rabbit IgG C-Term Polyclonal 0
8.585577 ABIN5011052 IF (p) IHC (p) Mouse IgG AA 680-715 7G8 0
7 ABIN6745719 IHC IHC (p) WB Rabbit IgG N-Term Polyclonal 0
7 ABIN2878761 ELISA IHC IHC (p) WB Rabbit IgG AA 694-743 Polyclonal 0
7 ABIN2878752 ELISA IHC IHC (p) WB Rabbit IgG pSer727 Polyclonal 0
7 ABIN6652043 IHC (p) WB Rabbit pTyr701 Polyclonal 4

General

Antigen Signal Transducer and Activator of Transcription 1, 91kDa (STAT1) Antibodies
Epitope AA 114-143, N-Term
(103), (75), (52), (18), (17), (15), (9), (8), (8), (8), (7), (6), (6), (6), (5), (5), (4), (4), (4), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity Human, Mouse (Murine), Rat (Rattus)
(556), (302), (269), (33), (29), (26), (22), (22), (16), (13), (11), (7), (7), (5), (2), (2), (2), (1), (1), (1), (1), (1)
Host Rabbit
(477), (108), (2), (1), (1)
Clonality
Polyclonal
Conjugate This STAT1 antibody is un-conjugated
(19), (15), (12), (10), (10), (10), (10), (10), (10), (6), (6), (4), (4), (4), (4), (4), (4), (2), (2), (2)
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(453), (209), (165), (110), (90), (52), (48), (18), (17), (9), (7), (6), (5), (3), (1), (1)
Pubmed 3 references available
Supplier

Product Details anti-STAT1 Antibody

Target Details STAT1 Application Details Handling References for anti-STAT1 antibody (ABIN3043938) Images
Purpose Rabbit IgG polyclonal antibody for Signal transducer and activator of transcription 1-alpha/beta (STAT1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Sequence KILENAQRFN QAQSGNIQST VMLDKQKELD
Cross-Reactivity (Details) No cross reactivity with other proteins.
Characteristics Rabbit IgG polyclonal antibody for Signal transducer and activator of transcription 1-alpha/beta (STAT1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: signal transducer and activator of transcription 1, 91 kDa
Protein Name: Signal transducer and activator of transcription 1-alpha/beta
Purification Immunogen affinity purified.
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human STAT1 (114-143aa KILENAQRFNQAQSGNIQSTVMLDKQKELD), different from the related mouse sequence by two amino acids.
Isotype IgG
Plasmids, Primers & others

Target Details STAT1

Product Details anti-STAT1 Antibody Application Details Handling References for anti-STAT1 antibody (ABIN3043938) Images back to top
Antigen
Alternative Name STAT1 (STAT1 Antibody Abstract)
Background Signal transducer and activator of transcription 1 (STAT1) is a transcription factor which in humans is encoded by the STAT1 gene. The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. Two alternatively spliced transcript variants encoding distinct isoforms have been described.

Synonyms: Signal transducer and activator of transcription 1 91kD antibody|DKFZp686B04100 antibody| ISGF 3 antibody|ISGF-3 antibody|OTTHUMP00000163552 antibody|OTTHUMP00000165046 antibody| OTTHUMP00000165047 antibody|OTTHUMP00000205845 antibody|Signal transducer and activator of transcription 1 91 kDa antibody|Signal transducer and activator of transcription 1 alpha/ beta antibody|Signal transducer and activator of transcription 1 antibody|Signal transducer and activator of transcription 1, 91kD antibody|Signal transducer and activator of transcription 1-alpha/beta antibody|Signal Transductor and Activator of Transcription 1 antibody|STAT 1 antibody|STAT 91 antibody|Stat1 antibody|STAT1_HUMAN antibody|STAT91 antibody|Transcription factor ISGF 3 components p91 p84 antibody|Transcription factor ISGF-3 components p91/p84 antibody
Gene ID 6772
UniProt P42224
Pathways JAK-STAT Signaling, RTK Signaling, Interferon-gamma Pathway, Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Endopeptidase Activity, Hepatitis C, CXCR4-mediated Signaling Events

Application Details

Product Details anti-STAT1 Antibody Target Details STAT1 Handling References for anti-STAT1 antibody (ABIN3043938) Images back to top
Application Notes WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Comment

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only

Handling

Product Details anti-STAT1 Antibody Target Details STAT1 Application Details References for anti-STAT1 antibody (ABIN3043938) Images back to top
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-STAT1 antibody (ABIN3043938)

Product Details anti-STAT1 Antibody Target Details STAT1 Application Details Handling Images back to top
Product cited in:

Liu, Li, Liang, Li, Jiang, Chu, Yang: "Hydrogen sulfide attenuates myocardial fibrosis in diabetic rats through the JAK/STAT signaling pathway." in: International journal of molecular medicine, Vol. 41, Issue 4, pp. 1867-1876, 2018

Song, Yang, Min, Liu, Zhao: "The effect of procyanidin on expression of STAT1 in type 2 diabetes mellitus SD rats with focal cerebral ischemia." in: Neuro endocrinology letters, Vol. 35, Issue 1, pp. 68-72, 2014

Gong, Cao, Jiang, Zhou, Liu: "Hepatitis C virus non-structural 5A abrogates signal transducer and activator of transcription-1 nuclear translocation induced by IFN-alpha through dephosphorylation." in: World journal of gastroenterology, Vol. 13, Issue 30, pp. 4080-4, 2007

Images

Product Details anti-STAT1 Antibody Target Details STAT1 Application Details Handling References for anti-STAT1 antibody (ABIN3043938) back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Signal Transducer and Activator of Transcription 1, 91kDa (STAT1) (AA 114-143), (N-Term) antibody (ABIN3043938) Anti- STAT1 Picoband antibody, IHC(P) IHC(P): Mouse Intestine Tissue
Immunohistochemistry (IHC) image for anti-Signal Transducer and Activator of Transcription 1, 91kDa (STAT1) (AA 114-143), (N-Term) antibody (ABIN3043938) Anti- STAT1 Picoband antibody, IHC(P) IHC(P): Human Mammary Cancer Tissue
Immunohistochemistry (IHC) image for anti-Signal Transducer and Activator of Transcription 1, 91kDa (STAT1) (AA 114-143), (N-Term) antibody (ABIN3043938) Anti- STAT1 Picoband antibody, IHC(P) IHC(P): Rat Intestine Tissue
Western Blotting (WB) image for anti-Signal Transducer and Activator of Transcription 1, 91kDa (STAT1) (AA 114-143), (N-Term) antibody (ABIN3043938) anti-Signal Transducer and Activator of Transcription 1, 91kDa (STAT1) (AA 114-143), (N-Term) antibody (Image 4)